PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00067.1.g02160.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family BBR-BPC
Protein Properties Length: 342aa    MW: 37984.9 Da    PI: 10.1187
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00067.1.g02160.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind3903.5e-119163421301
                       GAGA_bind   1 mdddgsre..rnkg.yye........paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkala 68 
                                     md+ g+re  r+++ +y+        p+++lk++ +++++++++e+d++irer++al+ekkaa+aerd+af+qrd+a+a
  Zjn_sc00067.1.g02160.1.sm.mkhc  16 MDNFGHREngRQRPdQYKamhtqwmmPQRQLKDHHSMNMLALMNEKDSAIRERDHALAEKKAAIAERDVAFAQRDAAMA 94 
                                     99****9999****99*99***9999889************************************************** PP

                       GAGA_bind  69 ernkalverdnkllalllvensla...salpvgvqvlsgtksidslqqlse.....pqledsave.lreeeklealpie 138
                                     ern+a+verdn+l+al+lv+ +     + +++ ++ lsgtk++++++qls+      ql+d +++ +re++++ea+pi+
  Zjn_sc00067.1.g02160.1.sm.mkhc  95 ERNAAIVERDNALAALELVRMNGYntnNGNGFHQGPLSGTKNTHHHDQLSHvqsssLQLADAPYDhAREMHISEAYPIS 173
                                     ****************9988766555588899999*************999899999********9************* PP

                       GAGA_bind 139 eaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesader......skaekksidlvlngvslDestlPvP 211
                                     +a+ ++ + kk++k++++ +p+++ +   +k++++++k+   +sa e+      sk+e+k++dl+ln+vs+Dest+P+P
  Zjn_sc00067.1.g02160.1.sm.mkhc 174 TAPGSVGKGKKPRKNHSQPSPLKRPSGVLRKTKKTNWKNGGLSSAGEDsarasvSKNEWKDQDLGLNQVSYDESTMPAP 252
                                     **************************98888777888887766665334678889************************ PP

                       GAGA_bind 212 vCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWA 290
                                     +CsCtG+lrqCYkWGnGGWqS+CCt++iS+yPLP++++rr+aR++grKmS+gaf+klL++LaaeG+dls+pvDLkdhWA
  Zjn_sc00067.1.g02160.1.sm.mkhc 253 ACSCTGKLRQCYKWGNGGWQSSCCTMSISMYPLPAMPNRRHARMGGRKMSGGAFTKLLSRLAAEGHDLSTPVDLKDHWA 331
                                     ******************************************************************************* PP

                       GAGA_bind 291 kHGtnkfvtir 301
                                     kHGtn+++tir
  Zjn_sc00067.1.g02160.1.sm.mkhc 332 KHGTNRYITIR 342
                                     **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.7E-9616342IPR010409GAGA-binding transcriptional activator
SMARTSM012267.8E-15816342IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
VIPSGLISWV QADVIMDNFG HRENGRQRPD QYKAMHTQWM MPQRQLKDHH SMNMLALMNE  60
KDSAIRERDH ALAEKKAAIA ERDVAFAQRD AAMAERNAAI VERDNALAAL ELVRMNGYNT  120
NNGNGFHQGP LSGTKNTHHH DQLSHVQSSS LQLADAPYDH AREMHISEAY PISTAPGSVG  180
KGKKPRKNHS QPSPLKRPSG VLRKTKKTNW KNGGLSSAGE DSARASVSKN EWKDQDLGLN  240
QVSYDESTMP APACSCTGKL RQCYKWGNGG WQSSCCTMSI SMYPLPAMPN RRHARMGGRK  300
MSGGAFTKLL SRLAAEGHDL STPVDLKDHW AKHGTNRYIT IR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001141822.10.0BBR/BPC transcription factor
RefseqXP_008658294.10.0PREDICTED: BBR/BPC transcription factor isoform X1
SwissprotQ5VSA80.0BBRD_ORYSJ; Barley B recombinant-like protein D
TrEMBLB4FYC00.0B4FYC0_MAIZE; BBR/BPC transcription factor
STRINGGRMZM2G118690_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62263756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.19e-99basic pentacysteine 6